PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016510843.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SRS
Protein Properties Length: 306aa    MW: 33627.1 Da    PI: 8.6427
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016510843.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702201.13.3e-621012383154
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                     +g+++CqdCGnqakkdC h+RCRtCC+ rgf+C+thvkstWvpaa+rrerqqq +            +++kr+r++   + s+l+ t+l++++s 
  XP_016510843.1 101 QGNVNCQDCGNQAKKDCPHSRCRTCCRGRGFQCQTHVKSTWVPAARRRERQQQFSE-----------NHPKRPRDN--ISGSSLAYTRLPTTSSG 182
                     7899**********************************************988654...........578999997..67889999999999888 PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      e+  s++P+ev+s+avfrcv+vs+v+d+e+++aYqtav+igGh+fkG+LydqG+++
  XP_016510843.1 183 LEVG-SHFPPEVNSPAVFRCVKVSGVEDAEQHYAYQTAVNIGGHIFKGMLYDQGPDQ 238
                     6665.55************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.9E-57103237IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.4E-25105147IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.4E-26188236IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MSWFFSLGGG KEQEQEELAT NNLLLFKNEA IYNKGFKLWQ QLQQRRPEQN HQNQEQDHVD  60
FSMCVGPASS SKPSNNNSNS SRSLGFRVMN MRGGGSSSGD QGNVNCQDCG NQAKKDCPHS  120
RCRTCCRGRG FQCQTHVKST WVPAARRRER QQQFSENHPK RPRDNISGSS LAYTRLPTTS  180
SGLEVGSHFP PEVNSPAVFR CVKVSGVEDA EQHYAYQTAV NIGGHIFKGM LYDQGPDQSR  240
YSSSGGGAGE SSSQPLNFIA GTTAAASSQQ QQGVSIALFD PASIYPNHHQ LSAFMAGTQF  300
FPPPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628417.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like isoform X1
RefseqXP_016510843.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9FXH73e-77SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLK4BVH63e-93K4BVH6_SOLLC; Uncharacterized protein
STRINGSolyc04g080970.2.18e-93(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-68SHI-related sequence 5